Loading...
Statistics
Advertisement

URD Solutions Benelux | Conversion of Corporate Branding to Local ...
www.urdsolution.nl/
URD Solutions is een facilitair service provider gespecialiseerd in het online toegankelijk maken van marketing materialen.

Urdsolution.nl

Domain is redirected to: Urdsolutions.nl
Advertisement
Conversion Technology Metas Server
Urdsolution.nl is hosted in France . Urdsolution.nl uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Google Font API, Html, Number of used javascripts: 4. First javascripts: Jquery.min.js, Jquery.mousewhe....4.pack.js, Jquery.fancybox-1.3.4.pack.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Urdsolution.nl

Technology

Number of occurences: 7
  • CSS
  • Google Font API
  • Html
  • Iframe
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 4
  • jquery.min.js
  • jquery.mousewheel-3.0.4.pack.js
  • jquery.fancybox-1.3.4.pack.js
  • jquery.nivo.slider.pack.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • nginx

Powered by

  • PleskLin

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Urdsolution.nl

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=SWsoft, Inc./OU=Plesk/CN=plesk/emailAddress=info@plesk.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: SWsoft, Inc.
      • OU: Plesk
      • CN: plesk
      • emailAddress: info@plesk.com
    • hash: d800aceb
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: SWsoft, Inc.
      • OU: Plesk
      • CN: plesk
      • emailAddress: info@plesk.com
    • version: 0
    • serialNumber: 1197298132
    • validFrom: 071210144853Z
    • validTo: 081209144853Z
    • validFrom_time_t: 1197298133
    • validTo_time_t: 1228834133
    • extensions:

    Meta - Urdsolution.nl

    Number of occurences: 3
    • Name:
      Content: text/html; charset=UTF-8
    • Name: generator
      Content: WordPress 3.4.2
    • Name: description
      Content: URD Solutions is een facilitair service provider gespecialiseerd in het online toegankelijk maken van marketing materialen.

    Server / Hosting

    • IP: 5.196.27.196
    • Latitude: 48.86
    • Longitude: 2.34
    • Country: France

    Rname

    • ns01.clickon-web.nl
    • ns02.clickon-web.nl
    • mail.urdsolution.nl

    Target

    • technical.clickon.nl

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: nginx Date: Fri, 15 Apr 2016 18:14:18 GMT Content-Type: text/html; charset=iso-8859-1 Connection: keep-alive Location: http://www.urdsoftware.nl/ HTTP/1.1 301 Moved Permanently Server: nginx Date: Fri, 15 Apr 2016 18:14:18 GMT Content-Type: text/html; charset=iso-8859-1 Connection: keep-alive Location: http://www.urdsolutions.nl/ HTTP/1.1 200 OK Server: nginx Date: Fri, 15 Apr 2016 18:14:19 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive X-Pingback: http://www.urdsolutions.nl/xmlrpc.php X-Powered-By: PleskLin

    DNS

    host: urdsolution.nl
    1. class: IN
    2. ttl: 59
    3. type: A
    4. ip: 5.196.27.196
    host: urdsolution.nl
    1. class: IN
    2. ttl: 60
    3. type: NS
    4. target: ns01.clickon-web.nl
    host: urdsolution.nl
    1. class: IN
    2. ttl: 60
    3. type: NS
    4. target: ns02.clickon-web.nl
    host: urdsolution.nl
    1. class: IN
    2. ttl: 60
    3. type: SOA
    4. mname: ns02.clickon-web.nl
    5. rname: technical.clickon.nl
    6. serial: 2015052201
    7. refresh: 60
    8. retry: 60
    9. expire: 60
    10. minimum-ttl: 60
    host: urdsolution.nl
    1. class: IN
    2. ttl: 60
    3. type: MX
    4. pri: 10
    5. target: mail.urdsolution.nl

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.rdsolution.nl, www.uwrdsolution.nl, www.wrdsolution.nl, www.uerdsolution.nl, www.erdsolution.nl, www.usrdsolution.nl, www.srdsolution.nl, www.uardsolution.nl, www.ardsolution.nl, www.udsolution.nl, www.uridsolution.nl, www.uidsolution.nl, www.urodsolution.nl, www.uodsolution.nl, www.urldsolution.nl, www.uldsolution.nl, www.urldsolution.nl, www.uldsolution.nl, www.ur.dsolution.nl, www.u.dsolution.nl, www.ursolution.nl, www.urdtsolution.nl, www.urtsolution.nl, www.urdgsolution.nl, www.urgsolution.nl, www.urdbsolution.nl, www.urbsolution.nl, www.urdxsolution.nl, www.urxsolution.nl, www.urdssolution.nl, www.urssolution.nl, www.urdfsolution.nl, www.urfsolution.nl, www.urdvsolution.nl, www.urvsolution.nl, www.urdysolution.nl, www.urysolution.nl, www.urdzsolution.nl, www.urzsolution.nl, www.urdasolution.nl, www.urasolution.nl, www.urdesolution.nl, www.uresolution.nl, www.urdrsolution.nl, www.urrsolution.nl, www.urdolution.nl, www.urdseolution.nl, www.urdeolution.nl, www.urdswolution.nl, www.urdwolution.nl, www.urdsdolution.nl, www.urddolution.nl, www.urdsxolution.nl, www.urdxolution.nl, www.urdsfolution.nl, www.urdfolution.nl, www.urdsgolution.nl, www.urdgolution.nl, www.urdstolution.nl, www.urdtolution.nl, www.urdsoblution.nl, www.urdsblution.nl, www.urdsohlution.nl, www.urdshlution.nl, www.urdsoglution.nl, www.urdsglution.nl, www.urdsojlution.nl, www.urdsjlution.nl, www.urdsomlution.nl, www.urdsmlution.nl, www.urdso lution.nl, www.urds lution.nl, www.urdsovlution.nl, www.urdsvlution.nl, www.urdsoution.nl, www.urdsoluution.nl, www.urdsouution.nl, www.urdsol8ution.nl, www.urdso8ution.nl, www.urdsol9ution.nl, www.urdso9ution.nl, www.urdsoljution.nl, www.urdsojution.nl, www.urdsol0ution.nl, www.urdso0ution.nl, www.urdsolmution.nl, www.urdsomution.nl, www.urdsolpution.nl, www.urdsopution.nl, www.urdsoloution.nl, www.urdsooution.nl, www.urdsoltion.nl, www.urdsoluwtion.nl, www.urdsolwtion.nl, www.urdsoluetion.nl, www.urdsoletion.nl, www.urdsolustion.nl, www.urdsolstion.nl, www.urdsoluation.nl, www.urdsolation.nl, www.urdsoluion.nl, www.urdsolutqion.nl, www.urdsoluqion.nl, www.urdsolutaion.nl, www.urdsoluaion.nl, www.urdsolut ion.nl, www.urdsolu ion.nl, www.urdsolutwion.nl, www.urdsoluwion.nl, www.urdsoluteion.nl, www.urdsolueion.nl, www.urdsolutzion.nl, www.urdsoluzion.nl, www.urdsolutxion.nl, www.urdsoluxion.nl, www.urdsolutcion.nl, www.urdsolucion.nl, www.urdsoluton.nl, www.urdsolutiron.nl, www.urdsolutron.nl, www.urdsolutifon.nl, www.urdsolutfon.nl, www.urdsolutivon.nl, www.urdsolutvon.nl, www.urdsolutikon.nl, www.urdsolutkon.nl, www.urdsoluti,on.nl, www.urdsolut,on.nl, www.urdsolutibon.nl, www.urdsolutbon.nl, www.urdsolutigon.nl, www.urdsolutgon.nl, www.urdsolutiton.nl, www.urdsolutton.nl, www.urdsolutiyon.nl, www.urdsolutyon.nl, www.urdsolutiuon.nl, www.urdsolutuon.nl, www.urdsolutijon.nl, www.urdsolutjon.nl, www.urdsolutimon.nl, www.urdsolutmon.nl, www.urdsolutinon.nl, www.urdsolutnon.nl, www.urdsolutin.nl, www.urdsolutiobn.nl, www.urdsolutibn.nl, www.urdsolutiohn.nl, www.urdsolutihn.nl, www.urdsolutiogn.nl, www.urdsolutign.nl, www.urdsolutiojn.nl, www.urdsolutijn.nl, www.urdsolutiomn.nl, www.urdsolutimn.nl, www.urdsolutio n.nl, www.urdsoluti n.nl, www.urdsolutiovn.nl, www.urdsolutivn.nl, www.urdsolutio.nl, www.urdsolutionn.nl, www.urdsolution.nl, www.urdsolutionh.nl, www.urdsolutioh.nl, www.urdsolutionj.nl, www.urdsolutioj.nl, www.urdsolutionk.nl, www.urdsolutiok.nl, www.urdsolutionl.nl, www.urdsolutiol.nl, www.urdsolution .nl, www.urdsolutio .nl,

    Other websites we recently analyzed

    1. vuki.science
      Austin (United States) - 209.99.40.219
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. Huron Valley Cabling and Consulting
      Business for Telephone and Computer Cabling
      Mountain View (United States) - 74.125.206.121
      Server software: ghs
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    3. physiciansadvancedfitnessmedicine.com
      Provo (United States) - 198.57.247.164
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    4. Sie werden weitergeleitet auf
      Germany - 134.119.245.118
      Server software: Apache/2.4.20
      Technology: Php
      Number of meta tags: 1
    5. lifestyle-urlaub
      Germany - 91.198.157.170
      G Analytics ID: UA-9440081-33
      Server software: Apache/2.2.21 (Win32) PHP/5.3.8 mod_perl/2.0.4 Perl/v5.10.1
      Technology: Html, Google Analytics
      Number of meta tags: 3
    6. czxtx.com
      Hong Kong - 103.61.240.87
      Server software: Microsoft-IIS/6.0
      Technology: Html, Html5, Javascript
      Number of meta tags: 1
    7. orangesunteamwear.net
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    8. Affordable Car Care Auto Repair Walton Hills Ohio
      Affordable Car Care is a family owned business delivering honest & professional auto repair & maintenance services to the people of Walton Hills, Macedonia, Sagamore Hills, Northfield, Solon, and surrounding areas.
      Phoenix (United States) - 69.50.216.99
      Server software: Apache
      Technology: CSS, Html, Javascript, Share This Social Media Buttons
      Number of Javascript: 4
      Number of meta tags: 4
    9. Fastshop 24
      Shop powered by PrestaShop
      Germany - 82.165.104.11
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Prestashop
      Number of Javascript: 12
      Number of meta tags: 5
    10. barristar.com
      Frankfurt (Germany) - 149.126.77.76
      Server software:
      Technology: Html, Iframe, Incapsula
      Number of meta tags: 1

    Check Other Websites